PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G26220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 370aa    MW: 41187.2 Da    PI: 6.9384
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G26220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.22.2e-5571361129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv++yL+kkv++kk++l +vik+vd+yk+ePwdL++  k+   e+++wyfFs++dkky+tg+r+nrat +g+Wkatg+dk+
  OGLUM02G26220.1   7 VPPGFRFHPTDEELVDYYLRKKVASKKIDL-DVIKDVDLYKIEPWDLQEkcKIGMeEQNDWYFFSHKDKKYPTGTRTNRATGAGFWKATGRDKP 99 
                      69****************************.9***************952433333556*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +++ +  lvg++ktLvfykgrap+g+k+dW+mheyrle
  OGLUM02G26220.1 100 IYA-RCCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                      ***.8889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-615156IPR003441NAC domain
PROSITE profilePS5100559.5677156IPR003441NAC domain
PfamPF023653.4E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKKIDLDVIK DVDLYKIEPW DLQEKCKIGM  60
EEQNDWYFFS HKDKKYPTGT RTNRATGAGF WKATGRDKPI YARCCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTTPEEGWVV CRVFKKRVAT VRRMADGSPC WFDDHGAVGA  180
FMPDLSSPRQ LLPHHHHHHP GSSAALYHGH HHQQLQQMYG HCKPELEYHH LLPQEAFLQH  240
LPQLESPKPP PPPPAAAAYI GGHLGSSSST ALTTHDDEAS GSAAQQQPPS LEAVYMAGAG  300
VGIGVDASVT DWRLLDKFVA SQLLSKESMS SYGSHPAQVF QAADGGKHEE ALDYASTSAG  360
SGGGEADLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-51615714169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0052910.0AP005291.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1282_H11.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622926.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-127NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0D9YVL50.0A0A0D9YVL5_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g42970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.13e-93NAC 007